Meeting Banner
Abstract #3095

Frequency-stabilized chemical exchange saturation transfer imaging with free induction decay readout

Ruibin Liu1, Hongxi Zhang2, Yi-Cheng Hsu3, Caixia Fu4, Yi Sun3, Dan Wu1, and Yi Zhang1
1Key Laboratory for Biomedical Engineering of Ministry of Education, Department of Biomedical Engineering, College of Biomedical Engineering & Instrument Science, Zhejiang University, Hangzhou, Zhejiang, China, 2Department of Radiology, Children's Hospital, Zhejiang University School of Medicine, Hangzhou, Zhejiang, China, 3MR Collaboration, Siemens Healthcare Ltd., Shanghai, China, 4Siemens Shenzhen Magnetic Resonance Ltd., Shenzhen, China

CEST imaging is highly sensitive to temporal B0 drift, for which a frequency-stabilized CEST (FS-CEST) sequence was recently proposed by inserting a frequency stabilization module in front of the conventional non-frequency-stabilized CEST (NFS-CEST) sequence. Here, the frequency stabilization module in the FS-CEST sequence was further simplified by replacing the original gradient-echo readout with free induction decay (FID) readout. The proposed FS-CEST sequence with FID readout in the frequency stabilization module was validated in phantoms on a 3T Siemens Prisma scanner and in 15 volunteers on a 3T Philips Achieva scanner, both leading to improved CEST maps.

This abstract and the presentation materials are available to members only; a login is required.

Join Here

readoutfrequencydriftspectrastabilizationtransfermodulesaturationproposedtemporalexchangephantomchemicalscannercolumndeltahumaninducedspacestabilizedacquisitionamidechinadecayfreegradientinductionpartsprotonrealscannerssubjectsuserbiomedicalbluecorrectcrossengineeringgreenhighlysimplifiedvendorvolunteersanteriorblackcircledconsistentcorrectedcorrectiondeepdetectingdiagramdissolveddurationexcitationfrontfunctionalfurthermoregrantgrayimprovedinsertingleadingmodulesoriginalpartphantomsprotons