Meeting Banner
Abstract #1841

Fluorine-19 MR Characterisation of Siponimod as MR Theranostic Approach in the Treatment of Multiple Sclerosis

Christian Prinz1, Fatima Sherazi1, Ludger Starke1, Paula Ramos Delgado1, Andre Kuehne2, Thoralf Niendorf1,2,3, and Sonia Waiczies1
1Berlin Ultrahigh Field Facility (B.U.F.F.), Max Delbrück Center for Molecular Medicine in the Helmholtz Association, Berlin, Germany, 2MRI TOOLS GmbH, Berlin, Germany, 3Experimental and Clinical Research Center, a joint cooperation between the Charité Medical Faculty and the Max Delbrück Center for Molecular Medicine in the Helmholtz Association, Berlin, Germany

Siponimod is a trifluorinated anti-inflammatory drug indicated for Multiple Sclerosis that could be potentially tracked in pharmacokinetic studies by fluorine-19 (19F) MR techniques in order to support therapeutic monitoring. In this study, we investigated the 19F MR properties of siponimod and its dependency on environmental factors. We found a temperature dependence of the relaxation times T1 and T2 and identified a T2-drop in the presence of human serum. We identified UTE as SNR-efficient MR pulse sequence to study siponimod physiologically and show the potential of tailoring MR methods in the future to individual patient therapeutic needs.

This abstract and the presentation materials are available to members only; a login is required.

Join Here

serumrarefluorinedrugpropertiesefficienciespulsetemperatureflashoptimizedchemicaldetectionefficiencymedicinepeakrevealedshortened