Meeting Banner
Abstract #4522

The need of a varying flip angle in multi-component analysis with IR-bSSFP sequences.

Martijn Nagtegaal1, Thomas Amthor2, Peter Koken2, and Mariya Doneva2

1TU Berlin, Berlin, Germany, 2Philips Research Europe, Hamburg, Germany

A comparative analysis between IR-bSSFP and MR Fingerprinting was performed in numerical simulations for single and multi-component parameter mapping. The single component matching works for both methods, although the accuracy for T2 is better for MR Fingerprinting. The multi component matching for a constant flip angle IR-bSSFP sequence can only match to the T1* values and cannot distinguish between the underlying T1/T2 values. Using the MR Fingerprinting sequence with a varying flip angle it is possible to match to the T1/T2 components.

This abstract and the presentation materials are available to members only; a login is required.

Join Here

componentmatchingcomponentsconstantcombinationsmatchedvaryingfingerprintingerrorcombinationeffectivemappingprecisionvariationconsiderednoiseplotssimultaneousaccuracydensitydistributionmulticomponentpulseunderlyingaccurateacquisitionalphaalthoughappliedbettercolumndecompositiondeviationdictionarydistinguishdotsestimationexponentialfrequencyindicateinversionleastmatchmixturesnegativenumericalpreparationprotonrealizationsrecovery