Meeting Banner
Abstract #0565

In vivo quantification of IONP-labeled PAR T-cells using positive contrast MRI

Jinjin Zhang1, Sidath C Kumarapperuma2, Qi Shao3, Lakmal Kotelawala2, John C Bischof3, Carston R Wagner2, and Michael Garwood1

1Center for Magnetic Resonance Research, Department of Radiology, University of Minnesota, Minneapolis, MN, United States, 2Department of Medicinal Chemistry, University of Minnesota, Minneapolis, MN, United States, 3Department of Mechanical Engineering, University of Minnesota, Minneapolis, MN, United States

Immunotherapies have received increasing attention as novel therapeutics for the treatment of cancer and autoimmune disease. In this study, IONP labeled PAR T-cells were tracked and quantified in vivo using the SWIFT sequence for positive contrast imaging and T1 mapping. The longitudinal relaxation rate constant (R1) showed a linear dependence on the cell density in vitro and thus was used to quantify T cell density in vivo in liver. These preliminary results demonstrate how positive contrast from an ultra-short T2 sensitive sequence can provide a tool to quantify the bio-distribution of T cells.

This abstract and the presentation materials are available to members only; a login is required.

Join Here

cellspostliverlabeledcontrastinjectioncellswifttreatedantitumorin vivopositivespleendasheddensitymapsmicequantifiedapparentlinearquantifyshortultraantigen