Meeting Banner
Abstract #1944

The effect of the chemical shift displacement artefact on J-modulation in the STEAM sequence

Carolina Campanha Fernandes 1 , Emma Louise Hall 1 , Chen Chen 1 , Peter Gordon Morris 1 , and Carlos Garrido Salmon 1,2

1 Sir Peter Mansfield Imaging Centre, University of Nottingham, Nottingham, United Kingdom, 2 Department of Physics, University of Sao Paulo, Ribeirao Preto, Brazil

The aim of this study is to derive an analytical model that takes into account the effects of the chemical shift displacement artefact (in three dimensions) on J-modulation of weakly coupled spins in the STEAM sequence. The signal modulation obtained theoretically was compared to the one obtained experimentally using a lactate phantom. This work demonstrated that significant changes in the coupled-spin response arise due to the chemical shift displacement artefact, especially at ultra-high magnetic field strengths. This model provides a means to predict the resulting lineshapes of metabolites of AXn form and is a useful tool for optimization of sequence timing parameters.

This abstract and the presentation materials are available to members only; a login is required.

Join Here

spinscompartmentspulseexperiencecompartmentmodelpulsessteamexperimentalmodulationcoupledcurveslactatespinanalyticaldisplacementdoubletwaterchemicalcombinationconsideredconsideringcontributionsderivederiveddimensionalequivalentfieldfrequencyfundedidealobservableonesoverallpeterrelatedrepresentsimulatedsimulationspectrastepstrengthstermsweaklyaccomplishedaccountacknowledgmentsactionsamplitudeariseaxisbest