Meeting Banner
Abstract #3291

Measuring the z-spectrum at various saturation powers simultaneously: development of a Look Locker- MT sequence

Olivier E Mougin 1 and Penny A Gowland 1

1 SPMMRC, University of Nottingham, Nottingham, Nottinghamshire, United Kingdom

A new magnetization transfer sequence based on a Look and Locker scheme is presented here. The optimization of the saturation as well as the imaging parameters was performed to get the highest CNR possible, focusing on the possibility to measure NOE and MT thanks to the different saturations available in the LL images, and this in a minimum amount of time.

This abstract and the presentation materials are available to members only; a login is required.

Join Here

saturationcontrastreadoutspectrapowerpowerstrainin vivoreadoutsspectrumacquisitionexchangeresolutionsensitivitywhiteasymmetryfrequencylockerlookmapsoffsetsoptimizepulsessimulations