Meeting Banner
Abstract #0684

Accelerated abdominal 4D flow MRI using 3D golden-angle cones trajectory

Christopher M. Sandino1, Joseph Y. Cheng2, Marcus T. Alley2, Michael Carl3, and Shreyas S. Vasanawala2

1Electrical Engineering, Stanford University, Stanford, CA, United States, 2Radiology, Stanford University, Stanford, CA, United States, 3Applied Sciences Laboratory, GE Healthcare, San Diego, CA, United States

4D flow MRI enables comprehensive abdominal evaluation, but long acquisition times and motion corruption limit its clinical applicability. To address these limitations, we present a 4D flow sequence with a 3D golden-angle reordered cones sampling trajectory. Cones has high sampling efficiency to allow for vastly accelerated scan times, and excellent aliasing properties that diffuse respiratory and bowel motion artifacts. To further improve motion-robustness, respiratory signals are estimated from each cone readout, and then used to suppress motion during reconstruction. We show that these techniques can be combined to achieve high quality abdominal 4D flow renderings in under 5 minutes.

This abstract and the presentation materials are available to members only; a login is required.

Join Here

flowconesmotionacquisitionartifactsreconstructionsamplingtrajectorysoftvelocityabdominalgoldengatingquantificationreadoutrespiratoryaccelerationaliasingcoilconeminutescardiacefficiencygatedlikepeakqualityradial