Meeting Banner
Abstract #1037

Functional 1H lung MRI in healthy and emphysematous rats using a self-gated golden angle UTE

smund Kjrstad 1 , Marta Tibiletti 2 , Andrea Bianchi 3 , Michael Neumaier 3 , Andrea Vgtle 3 , Thomas Kaulisch 3 , Frank G. Zllner 1 , Lothar R. Schad 1 , Volker Rasche 2 , and Detlef Stiller 3

1 Computer Assisted Clinical Medicine, Medical Faculty Mannheim, Heidelberg University, Mannheim, Germany, 2 Core Facility Small Animal MRI, Ulm University, Ulm, Germany, 3 Target Discovery Research, In-vivo imaging laboratory, Boehringer Ingelheim Pharma GmbH & Co. KG, Biberach an der Riss, Germany

Using the 1H MRI signal difference in the lung parenchyma at inspiration and expiration during normal breathing is a promising method for assessing lung function. However, due to the difficulties of self-gating in rodents no animal studies have so far been performed using this method. For the first time we demonstrate here the feasibility of the method in small animals by evaluating the lung function in rats with emphysema using a self-gating golden angle 2D UTE sequence and a thorax-optimized phased-array coil.

This abstract and the presentation materials are available to members only; a login is required.

Join Here

lungexpansionlungsreductionadministrationafflictedanimalsratscoilexpirationfunctiongatinginspirationintensityselfweeksanimalarrayemphysemagoldenhealthymaps